Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
Its dehydrogenation activity from (S)-malate to oxaloacetate in the presense of NAD+ is determined to be greater than 1000 pmol/min/ug
Research Area
Signal Transduction
Alternative Names
cytoplasmic; Cytosolic malate dehydrogenase; Diiodophenylpyruvate reductase; Malate dehydrogenase 1, NAD (soluble); Malate dehydrogenase; Malate dehydrogenase cytoplasmic; MDH s; mdh1; MDHA; MDHC_HUMAN; MDHs; MGC:1375; MOR2; Soluble malate dehydrogenase
Species
Homo sapiens (Human)
Expression Region
2-334aa
Complete Sequence
SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Buffer
0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Recombinant Human MDH1 is a full-length cytoplasmic malate dehydrogenase protein, including the 2-334aa expression region. Sourced from E. coli, this protein has a C-terminal 6xHis-tag and plays a vital role in signal transduction research. Demonstrating a purity of greater than 95% as verified by SDS-PAGE, MDH1 maintains an endotoxin level of less than 1.0 EU/µg, as determined by the LAL method. This protein showcases a robust dehydrogenation activity, converting (S)-malate to oxaloacetate in the presence of NAD+ at a rate greater than 1000 pmol/min/µg. The lyophilized powder format ensures ease of storage and application in a wide range of research endeavors.